PPP2CA (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPP2CA full-length ORF ( NP_002706.1, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
62
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPP2CA
Entrez GeneID
5515GeneBank Accession#
NM_002715.2Protein Accession#
NP_002706.1Gene Name
PPP2CA
Gene Alias
PP2Ac, PP2CA, RP-C
Gene Description
protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform
Omim ID
176915Gene Ontology
HyperlinkGene Summary
This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. [provided by RefSeq
Other Designations
PP2A-alpha|protein phosphatase 2, catalytic subunit, alpha isoform|replication protein C|serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform|serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
SET antagonist enhances the chemosensitivity of non-small cell lung cancer cells by reactivating protein phosphatase 2A.
Hung MH, Wang CY, Chen YL, Chu PY, Hsiao YJ, Tai WT, Chao TT, Yu HC, Shiau CW, Chen KF.
Oncotarget 2016 Jan; 7(1):638.
Application：IP-WB, WB-Re, SPR, Human, A549, H460, H358 cells.
-
SET antagonist enhances the chemosensitivity of non-small cell lung cancer cells by reactivating protein phosphatase 2A.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com