PPP1R10 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPP1R10 partial ORF ( NP_002705.2, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.87
Interspecies Antigen Sequence
Mouse (95); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPP1R10
Entrez GeneID
5514GeneBank Accession#
NM_002714Protein Accession#
NP_002705.2Gene Name
PPP1R10
Gene Alias
CAT53, FB19, PNUTS, PP1R10
Gene Description
protein phosphatase 1, regulatory (inhibitor) subunit 10
Omim ID
603771Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with similarity to a rat protein that has an inhibitory effect on protein phosphatase-1 (PP1). The rat protein localizes to the nucleus and colocalizes with chromatin at distinct phases during mitosis. This gene lies within the major histocompatibility complex class I region on chromosome 6. [provided by RefSeq
Other Designations
phosphatase nuclear targeting subunit|protein phosphatase 1 regulatory subunit 10|protein phosphatase 1, regulatory subunit 10
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com