Product Browser

Last updated: 2017/12/10
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1R10 monoclonal antibody (M02), clone 1D6

  • Catalog # : H00005514-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PPP1R10.
  • Immunogen:
  • PPP1R10 (NP_002705.2, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005514-M02
    Western Blot detection against Immunogen (34.87 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PPP1R10 expression in transfected 293T cell line by PPP1R10 monoclonal antibody (M02), clone 1D6.

    Lane 1: PPP1R10 transfected lysate(99.1 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5514
  • Gene Name:
  • PPP1R10
  • Gene Alias:
  • CAT53,FB19,PNUTS,PP1R10
  • Gene Description:
  • protein phosphatase 1, regulatory (inhibitor) subunit 10
  • Gene Summary:
  • This gene encodes a protein with similarity to a rat protein that has an inhibitory effect on protein phosphatase-1 (PP1). The rat protein localizes to the nucleus and colocalizes with chromatin at distinct phases during mitosis. This gene lies within the major histocompatibility complex class I region on chromosome 6. [provided by RefSeq
  • Other Designations:
  • phosphatase nuclear targeting subunit,protein phosphatase 1 regulatory subunit 10,protein phosphatase 1, regulatory subunit 10
  • RSS
  • YouTube
  • Linkedin
  • Facebook