PPP1R8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPP1R8 partial ORF ( NP_002704.1, 28 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPP1R8
Entrez GeneID
5511GeneBank Accession#
NM_002713Protein Accession#
NP_002704.1Gene Name
PPP1R8
Gene Alias
ARD-1, ARD1, NIPP-1, NIPP1, PRO2047
Gene Description
protein phosphatase 1, regulatory (inhibitor) subunit 8
Omim ID
602636Gene Ontology
HyperlinkGene Summary
This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA. [provided by RefSeq
Other Designations
OTTHUMP00000003847|OTTHUMP00000003848|OTTHUMP00000003849|OTTHUMP00000044938|RNase E|activator of RNA decay|nuclear inhibitor of protein phosphatase-1|nuclear subunit of PP-1|protein phosphatase 1 regulatory inhibitor subunit 8|protein phosphatase 1 regula
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com