Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1R8 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005511-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPP1R8 partial ORF ( NP_002704.1, 28 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005511-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5511
  • Gene Name:
  • PPP1R8
  • Gene Alias:
  • ARD-1,ARD1,NIPP-1,NIPP1,PRO2047
  • Gene Description:
  • protein phosphatase 1, regulatory (inhibitor) subunit 8
  • Gene Summary:
  • This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000003847,OTTHUMP00000003848,OTTHUMP00000003849,OTTHUMP00000044938,RNase E,activator of RNA decay,nuclear inhibitor of protein phosphatase-1,nuclear subunit of PP-1,protein phosphatase 1 regulatory inhibitor subunit 8,protein phosphatase 1 regula
  • RSS
  • YouTube
  • Linkedin
  • Facebook