Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1R8 monoclonal antibody (M05), clone 4B5

  • Catalog # : H00005511-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PPP1R8.
  • Immunogen:
  • PPP1R8 (NP_002704.1, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005511-M05
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PPP1R8 expression in transfected 293T cell line by PPP1R8 monoclonal antibody (M05), clone 4B5.

    Lane 1: PPP1R8 transfected lysate (Predicted MW: 38.5 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of PPP1R8 transfected lysate using anti-PPP1R8 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PPP1R8 monoclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PPP1R8 is approximately 3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5511
  • Gene Name:
  • PPP1R8
  • Gene Alias:
  • ARD-1,ARD1,NIPP-1,NIPP1,PRO2047
  • Gene Description:
  • protein phosphatase 1, regulatory (inhibitor) subunit 8
  • Gene Summary:
  • This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000003847,OTTHUMP00000003848,OTTHUMP00000003849,OTTHUMP00000044938,RNase E,activator of RNA decay,nuclear inhibitor of protein phosphatase-1,nuclear subunit of PP-1,protein phosphatase 1 regulatory inhibitor subunit 8,protein phosphatase 1 regula
  • RSS
  • YouTube
  • Linkedin
  • Facebook