Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1R2 polyclonal antibody (A01)

  • Catalog # : H00005504-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPP1R2.
  • Immunogen:
  • PPP1R2 (NP_006232, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005504-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PPP1R2 polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of PPP1R2 expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5504
  • Gene Name:
  • PPP1R2
  • Gene Alias:
  • IPP2,MGC87148
  • Gene Description:
  • protein phosphatase 1, regulatory (inhibitor) subunit 2
  • Other Designations:
  • phosphoprotein phosphatase,protein phosphatase 1, regulatory subunit 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook