Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1CB (Human) Recombinant Protein (Q01)

  • Catalog # : H00005500-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPP1CB partial ORF ( NP_002700, 231 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.41
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005500-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5500
  • Gene Name:
  • PPP1CB
  • Gene Alias:
  • MGC3672,PP-1B,PPP1CD
  • Gene Description:
  • protein phosphatase 1, catalytic subunit, beta isoform
  • Gene Summary:
  • The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
  • Other Designations:
  • protein phosphatase 1, catalytic subunit, beta,protein phosphatase 1, catalytic subunit, delta isoform,protein phosphatase 1-beta,protein phosphatase 1-delta,serine/threonine protein phosphatase PP1-beta catalytic subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook