PPP1CB (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPP1CB partial ORF ( NP_002700, 231 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.41
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPP1CB
Entrez GeneID
5500GeneBank Accession#
NM_002709Protein Accession#
NP_002700Gene Name
PPP1CB
Gene Alias
MGC3672, PP-1B, PPP1CD
Gene Description
protein phosphatase 1, catalytic subunit, beta isoform
Omim ID
600590Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
protein phosphatase 1, catalytic subunit, beta|protein phosphatase 1, catalytic subunit, delta isoform|protein phosphatase 1-beta|protein phosphatase 1-delta|serine/threonine protein phosphatase PP1-beta catalytic subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com