PPP1CB purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PPP1CB expression in transfected 293T cell line (H00005500-T02) by PPP1CB MaxPab polyclonal antibody.
Lane 1: PPP1CB transfected lysate(35.97 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PPP1CB protein.
Immunogen
PPP1CB (NP_002700.1, 1 a.a. ~ 327 a.a) full-length human protein.
Sequence
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PPP1CB expression in transfected 293T cell line (H00005500-T02) by PPP1CB MaxPab polyclonal antibody.
Lane 1: PPP1CB transfected lysate(35.97 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PPP1CB
Entrez GeneID
5500GeneBank Accession#
NM_002709.2Protein Accession#
NP_002700.1Gene Name
PPP1CB
Gene Alias
MGC3672, PP-1B, PPP1CD
Gene Description
protein phosphatase 1, catalytic subunit, beta isoform
Omim ID
600590Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
protein phosphatase 1, catalytic subunit, beta|protein phosphatase 1, catalytic subunit, delta isoform|protein phosphatase 1-beta|protein phosphatase 1-delta|serine/threonine protein phosphatase PP1-beta catalytic subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com