PPP1CA polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PPP1CA.
Immunogen
PPP1CA (NP_002699, 224 a.a. ~ 330 a.a) partial recombinant protein with GST tag.
Sequence
SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.88 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPP1CA polyclonal antibody (A01), Lot # 060102JCO1 Western Blot analysis of PPP1CA expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPP1CA
Entrez GeneID
5499GeneBank Accession#
NM_002708Protein Accession#
NP_002699Gene Name
PPP1CA
Gene Alias
MGC15877, MGC1674, PP-1A, PPP1A
Gene Description
protein phosphatase 1, catalytic subunit, alpha isoform
Omim ID
176875Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
protein phosphatase 1, catalytic subunit, alpha|serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com