Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1CA polyclonal antibody (A01)

  • Catalog # : H00005499-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPP1CA.
  • Immunogen:
  • PPP1CA (NP_002699, 224 a.a. ~ 330 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005499-A01
    Western Blot detection against Immunogen (37.88 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PPP1CA polyclonal antibody (A01), Lot # 060102JCO1 Western Blot analysis of PPP1CA expression in HL-60 ( Cat # L014V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5499
  • Gene Name:
  • PPP1CA
  • Gene Alias:
  • MGC15877,MGC1674,PP-1A,PPP1A
  • Gene Description:
  • protein phosphatase 1, catalytic subunit, alpha isoform
  • Gene Summary:
  • The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • protein phosphatase 1, catalytic subunit, alpha,serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook