Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPM1G polyclonal antibody (A01)

  • Catalog # : H00005496-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPM1G.
  • Immunogen:
  • PPM1G (NP_817092, 462 a.a. ~ 544 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005496-A01
    Western Blot detection against Immunogen (35.24 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5496
  • Gene Name:
  • PPM1G
  • Gene Alias:
  • MGC1675,MGC2870,PP2CG,PP2CGAMMA,PPP2CG
  • Gene Description:
  • protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform
  • Gene Summary:
  • The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000123426,PP2C, gamma,protein phosphatase 1C,protein phosphatase 1G,protein phosphatase 2, catalytic subunit, gamma isoform,protein phosphatase 2C gamma isoform,protein phosphatase magnesium-dependent 1 gamma
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook