PPM1B monoclonal antibody (M01), clone 1A3-2A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PPM1B expression in transfected 293T cell line by PPM1B monoclonal antibody (M01), clone 1A3-2A4.
Lane 1: PPM1B transfected lysate(52.643 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of PPM1B transfected lysate using anti-PPM1B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPM1B monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPM1B is 0.3 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of PPM1B over-expressed 293 cell line, cotransfected with PPM1B Validated Chimera RNAi ( Cat # H00005495-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPM1B monoclonal antibody (M01), clone 1A3-2A4 (Cat # H00005495-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between ARRB2 and PPM1B. HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 and anti-PPM1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to PPM1B on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (46.86 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PPM1B.
Immunogen
PPM1B (AAH12002, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (46.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PPM1B expression in transfected 293T cell line by PPM1B monoclonal antibody (M01), clone 1A3-2A4.
Lane 1: PPM1B transfected lysate(52.643 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of PPM1B transfected lysate using anti-PPM1B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPM1B monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPM1B is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PPM1B over-expressed 293 cell line, cotransfected with PPM1B Validated Chimera RNAi ( Cat # H00005495-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPM1B monoclonal antibody (M01), clone 1A3-2A4 (Cat # H00005495-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between ARRB2 and PPM1B. HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 and anti-PPM1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to PPM1B on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PPM1B
Entrez GeneID
5495GeneBank Accession#
BC012002Protein Accession#
AAH12002Gene Name
PPM1B
Gene Alias
MGC21657, PP2C-beta-X, PP2CB, PP2CBETA, PPC2BETAX
Gene Description
protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
Omim ID
603770Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences. [provided by RefSeq
Other Designations
OTTHUMP00000158953|OTTHUMP00000158955|protein phosphatase 1B|protein phosphatase 2C beta isoform|protein phosphatase 2C-like protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com