Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIA (Human) Recombinant Protein (P02)

  • Catalog # : H00005478-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPIA full-length ORF ( NP_001008741.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005478-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5478
  • Gene Name:
  • PPIA
  • Gene Alias:
  • CYPA,CYPH,MGC117158,MGC12404,MGC23397
  • Gene Description:
  • peptidylprolyl isomerase A (cyclophilin A)
  • Gene Summary:
  • This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000025305,PPIase A,T cell cyclophilin,cyclosporin A-binding protein,peptidyl-prolyl cis-trans isomerase A,peptidylprolyl isomerase A,rotamase A
  • RSS
  • YouTube
  • Linkedin
  • Facebook