PPIA (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPIA full-length ORF ( AAH00689.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.89
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPIA
Entrez GeneID
5478GeneBank Accession#
BC000689Protein Accession#
AAH00689.1Gene Name
PPIA
Gene Alias
CYPA, CYPH, MGC117158, MGC12404, MGC23397
Gene Description
peptidylprolyl isomerase A (cyclophilin A)
Omim ID
123840Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq
Other Designations
OTTHUMP00000025305|PPIase A|T cell cyclophilin|cyclosporin A-binding protein|peptidyl-prolyl cis-trans isomerase A|peptidylprolyl isomerase A|rotamase A
-
Interactome
-
Disease
-
Publication Reference
-
A JNK-mediated autophagy pathway that triggers c-IAP degradation and necroptosis for anticancer chemotherapy.
He W, Wang Q, Srinivasan B, Xu J, Padilla MT, Li Z, Wang X, Liu Y, Gou X, Shen HM, Xing C, Lin Y.
Oncogene 2014 Jun; 33(23):3004.
Application：WB, Human, A549 cells.
-
AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX.
Artus C, Boujrad H, Bouharrour A, Brunelle MN, Hoos S, Yuste VJ, Lenormand P, Rousselle JC, Namane A, England P, Lorenzo HK, Susin SA.
The EMBO Journal 2010 May; 29(9):1585.
Application：Func, Mouse, MEFs.
-
A JNK-mediated autophagy pathway that triggers c-IAP degradation and necroptosis for anticancer chemotherapy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com