PPIA monoclonal antibody (M01), clone 1F4-1B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PPIA monoclonal antibody (M01), clone 1F4-1B5 Western Blot analysis of PPIA expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PPIA expression in transfected 293T cell line by PPIA monoclonal antibody (M01), clone 1F4-1B5.
Lane 1: PPIA transfected lysate(18 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPIA is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (43.89 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PPIA.
Immunogen
PPIA (AAH00689.1, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPIA monoclonal antibody (M01), clone 1F4-1B5 Western Blot analysis of PPIA expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PPIA expression in transfected 293T cell line by PPIA monoclonal antibody (M01), clone 1F4-1B5.
Lane 1: PPIA transfected lysate(18 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPIA is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — PPIA
Entrez GeneID
5478GeneBank Accession#
BC000689Protein Accession#
AAH00689.1Gene Name
PPIA
Gene Alias
CYPA, CYPH, MGC117158, MGC12404, MGC23397
Gene Description
peptidylprolyl isomerase A (cyclophilin A)
Omim ID
123840Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq
Other Designations
OTTHUMP00000025305|PPIase A|T cell cyclophilin|cyclosporin A-binding protein|peptidyl-prolyl cis-trans isomerase A|peptidylprolyl isomerase A|rotamase A
-
Interactome
-
Disease
-
Publication Reference
-
Establishment of a Novel Cell Line for the Enhanced Production of Recombinant AAV Vectors for Gene Therapy.
Satkunanathan S, Wheeler J, Thorpe R, Zhao Y.
Human Gene Therapy 2014 Nov; 25(11):929.
Application：WB-Tr, Human, 293T cells.
-
Peripheral blood monocyte-expressed ANXA2 geneis involved in pathogenesis of osteoporosis in humans.
Deng FY, Lei SF, Zhang Y, Zhang YL, Zheng YP, Zhang LS, Pan R, Wang L, Tian Q, Shen H, Zhao M, Lundberg YW, Liu YZ, Papasian CJ, Deng HW.
Molecular & Cellular proteomics: MCP 2011 Nov; 10(11):M111.01170.
Application：WB-Ce, Human, Peripheral blood monocytes.
-
Tissue proteomics reveals differential and compartment-specific expression of the homologs transgelin and transgelin-2 in lung adenocarcinoma and its stroma.
Rho JH, Roehrl MH, Wang JY.
Journal of Proteome Research 2009 Dec; 8(12):5610.
Application：WB-Ti, Human, Human lung carcinoma, adjacent normal lung parenchyma tissues.
-
Establishment of a Novel Cell Line for the Enhanced Production of Recombinant AAV Vectors for Gene Therapy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com