Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIA purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00005478-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PPIA protein.
  • Immunogen:
  • PPIA (NP_066953.1, 1 a.a. ~ 165 a.a) full-length human protein.
  • Sequence:
  • MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PPIA expression in transfected 293T cell line (H00005478-T02) by PPIA MaxPab polyclonal antibody.

    Lane 1: PPIA transfected lysate(18.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5478
  • Gene Name:
  • PPIA
  • Gene Alias:
  • CYPA,CYPH,MGC117158,MGC12404,MGC23397
  • Gene Description:
  • peptidylprolyl isomerase A (cyclophilin A)
  • Gene Summary:
  • This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000025305,PPIase A,T cell cyclophilin,cyclosporin A-binding protein,peptidyl-prolyl cis-trans isomerase A,peptidylprolyl isomerase A,rotamase A
  • RSS
  • YouTube
  • Linkedin
  • Facebook