PPIA polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (44.26 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant PPIA.
Immunogen
PPIA (AAH00689.1, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag.
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44.26 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPIA
Entrez GeneID
5478GeneBank Accession#
BC000689Protein Accession#
AAH00689.1Gene Name
PPIA
Gene Alias
CYPA, CYPH, MGC117158, MGC12404, MGC23397
Gene Description
peptidylprolyl isomerase A (cyclophilin A)
Omim ID
123840Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq
Other Designations
OTTHUMP00000025305|PPIase A|T cell cyclophilin|cyclosporin A-binding protein|peptidyl-prolyl cis-trans isomerase A|peptidylprolyl isomerase A|rotamase A
-
Interactome
-
Disease
-
Publication Reference
-
Serum Analysis of Women with Early-Stage Breast Cancer Using a Mini-Array of Tumor-Associated Antigens.
Alma Rosa Oaxaca-Camacho, Oscar René Ochoa-Mojica, Adriana Aguilar-Lemarroy, Luis F Jave-Suárez, José Francisco Muñoz-Valle, Eduardo Padilla-Camberos, Juan Antonio Núñez-Hernández, Sara E Herrera-Rodríguez, Moisés Martínez-Velázquez, Ahtziri Socorro Carranza-Aranda, José Alfonso Cruz-Ramos, Abel Gutiérrez-Ortega, Rodolfo Hernández-Gutiérrez.
Biosensors 2020 Oct; 10(10):149.
Application：Dot, WB, Human, Serum from women with early-stage breast cancer.
-
Serum Analysis of Women with Early-Stage Breast Cancer Using a Mini-Array of Tumor-Associated Antigens.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com