Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIA polyclonal antibody (A01)

  • Catalog # : H00005478-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant PPIA.
  • Immunogen:
  • PPIA (AAH00689.1, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005478-A01
    Western Blot detection against Immunogen (44.26 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5478
  • Gene Name:
  • PPIA
  • Gene Alias:
  • CYPA,CYPH,MGC117158,MGC12404,MGC23397
  • Gene Description:
  • peptidylprolyl isomerase A (cyclophilin A)
  • Gene Summary:
  • This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000025305,PPIase A,T cell cyclophilin,cyclosporin A-binding protein,peptidyl-prolyl cis-trans isomerase A,peptidylprolyl isomerase A,rotamase A
  • RSS
  • YouTube
  • Linkedin
  • Facebook