Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPBP (Human) Recombinant Protein (Q01)

  • Catalog # : H00005473-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPBP partial ORF ( AAH28217, 37 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.75
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005473-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5473
  • Gene Name:
  • PPBP
  • Gene Alias:
  • B-TG1,Beta-TG,CTAP-III,CTAP3,CTAPIII,CXCL7,LA-PF4,LDGF,MDGF,NAP-2,PBP,SCYB7,TC1,TC2,TGB,TGB1,THBGB,THBGB1
  • Gene Description:
  • pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
  • Gene Summary:
  • The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and sythesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. [provided by RefSeq
  • Other Designations:
  • CXC chemokine ligand 7,beta-thromboglobulin,connective tissue-activating peptide III,leukocyte-derived growth factor,low-affinity platelet factor IV,macrophage-derived growth factor,neutrophil-activating peptide 2,neutrophil-activating peptide-2,platelet
  • RSS
  • YouTube
  • Linkedin
  • Facebook