Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPARG polyclonal antibody (A01)

  • Catalog # : H00005468-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPARG.
  • Immunogen:
  • PPARG (NP_619726, 366 a.a. ~ 475 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5468
  • Gene Name:
  • PPARG
  • Gene Alias:
  • CIMT1,NR1C3,PPARG1,PPARG2,PPARgamma
  • Gene Description:
  • peroxisome proliferator-activated receptor gamma
  • Gene Summary:
  • This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000185030,OTTHUMP00000185033,OTTHUMP00000185037,PPAR gamma,nuclear receptor subfamily 1 group C member 3,peroxisome proliferative activated receptor gamma,peroxisome proliferative activated receptor, gamma,peroxisome proliferator activated recept
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook