Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPA1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00005464-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PPA1 protein.
  • Immunogen:
  • PPA1 (ABM84523.1, 1 a.a. ~ 289 a.a) full-length human protein.
  • Sequence:
  • MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Entrez GeneID:
  • 5464
  • Gene Name:
  • PPA1
  • Gene Alias:
  • IOPPP,MGC111556,PP,PP1,SID6-8061
  • Gene Description:
  • pyrophosphatase (inorganic) 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019741,PPase,cytosolic inorganic pyrophosphatase,diphosphate phosphohydrolase,inorganic diphosphatase,inorganic pyrophosphatase 1,pyrophosphatase 1,pyrophosphate phospho-hydrolase
  • RSS
  • YouTube
  • Linkedin
  • Facebook