POU4F3 monoclonal antibody (M01), clone 5B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
POU4F3 monoclonal antibody (M01), clone 5B8 Western Blot analysis of POU4F3 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of POU4F3 expression in transfected 293T cell line by POU4F3 monoclonal antibody (M01), clone 5B8.
Lane 1: POU4F3 transfected lysate(37.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POU4F3 is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi ( Cat # H00005459-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody (M01), clone 5B8 (Cat # H00005459-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to POU4F3 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.75 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant POU4F3.
Immunogen
POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
POU4F3 monoclonal antibody (M01), clone 5B8 Western Blot analysis of POU4F3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of POU4F3 expression in transfected 293T cell line by POU4F3 monoclonal antibody (M01), clone 5B8.
Lane 1: POU4F3 transfected lysate(37.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POU4F3 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi ( Cat # H00005459-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody (M01), clone 5B8 (Cat # H00005459-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to POU4F3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — POU4F3
Entrez GeneID
5459GeneBank Accession#
NM_002700Protein Accession#
NP_002691Gene Name
POU4F3
Gene Alias
BRN3C, DFNA15, MGC138412
Gene Description
POU class 4 homeobox 3
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of non-syndromic sensorineural deafness autosomal dominant type 15. [provided by RefSeq
Other Designations
POU domain, class 4, transcription factor 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com