Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POU4F3 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00005459-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human POU4F3 protein.
  • Immunogen:
  • POU4F3 (NP_002691.1, 1 a.a. ~ 338 a.a) full-length human protein.
  • Sequence:
  • MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of POU4F3 transfected lysate using anti-POU4F3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with POU4F3 purified MaxPab mouse polyclonal antibody (B01P) (H00005459-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 5459
  • Gene Name:
  • POU4F3
  • Gene Alias:
  • BRN3C,DFNA15,MGC138412
  • Gene Description:
  • POU class 4 homeobox 3
  • Gene Summary:
  • This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of non-syndromic sensorineural deafness autosomal dominant type 15. [provided by RefSeq
  • Other Designations:
  • POU domain, class 4, transcription factor 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook