POU4F3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant POU4F3.
Immunogen
POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Sequence
PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
ELISA
-
Gene Info — POU4F3
Entrez GeneID
5459GeneBank Accession#
NM_002700Protein Accession#
NP_002691Gene Name
POU4F3
Gene Alias
BRN3C, DFNA15, MGC138412
Gene Description
POU class 4 homeobox 3
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of non-syndromic sensorineural deafness autosomal dominant type 15. [provided by RefSeq
Other Designations
POU domain, class 4, transcription factor 3
-
Interactome
-
Publication Reference
-
Generation of Otic Lineages from Integration-Free Human-Induced Pluripotent Stem Cells Reprogrammed by mRNAs.
Sarah L Boddy, Ricardo Romero-Guevara, Ae-Ri Ji, Christian Unger, Laura Corns, Walter Marcotti, Marcelo N Rivolta.
Stem Cells International 2020 Mar; 2020:3692937.
Application：IF, Human, MIFF1 cells.
-
Human Fetal Auditory Stem Cells Can Be Expanded In Vitro and Differentiate Into Functional Auditory Neurons and Hair Cell-Like Cells.
Chen W, Johnson SL, Marcotti W, Andrews PW, Moore HD, Rivolta MN.
Stem Cells 2009 May; 27(5):1196.
Application：IF, Human, Human fetal auditory stem cells.
-
Generation of Otic Lineages from Integration-Free Human-Induced Pluripotent Stem Cells Reprogrammed by mRNAs.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com