Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POU4F3 polyclonal antibody (A01)

  • Catalog # : H00005459-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant POU4F3.
  • Immunogen:
  • POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5459
  • Gene Name:
  • POU4F3
  • Gene Alias:
  • BRN3C,DFNA15,MGC138412
  • Gene Description:
  • POU class 4 homeobox 3
  • Gene Summary:
  • This gene encodes a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. This protein is found in the retina and may play a role in determining or maintaining the identities of a small subset of visual system neurons. Defects in this gene are the cause of non-syndromic sensorineural deafness autosomal dominant type 15. [provided by RefSeq
  • Other Designations:
  • POU domain, class 4, transcription factor 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook