Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POU3F4 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00005456-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human POU3F4 protein.
  • Immunogen:
  • POU3F4 (AAI46552.1, 1 a.a. ~ 361 a.a) full-length human protein.
  • Sequence:
  • MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEGLQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of POU3F4 expression in transfected 293T cell line (H00005456-T01) by POU3F4 MaxPab polyclonal antibody.

    Lane 1: POU3F4 transfected lysate(39.71 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5456
  • Gene Name:
  • POU3F4
  • Gene Alias:
  • BRAIN-4,BRN4,DFN3,DFNX2,OTF9
  • Gene Description:
  • POU class 3 homeobox 4
  • Gene Summary:
  • This gene encodes a member of the POU-III class of neural transcription factors. This gene may play a role in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations have been associated with X chromosome-linked nonsyndromic mixed deafness. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023616,POU domain, class 3, transcription factor 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook