POU3F2 monoclonal antibody (M01), clone 6F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant POU3F2.
Immunogen
POU3F2 (NP_005595, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
POU3F2 monoclonal antibody (M01), clone 6F6. Western Blot analysis of POU3F2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of POU3F2 expression in transfected 293T cell line by POU3F2 monoclonal antibody (M01), clone 6F6.
Lane 1: POU3F2 transfected lysate(46.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POU3F2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — POU3F2
Entrez GeneID
5454GeneBank Accession#
NM_005604Protein Accession#
NP_005595Gene Name
POU3F2
Gene Alias
BRN2, OCT7, OTF7, POUF3
Gene Description
POU class 3 homeobox 2
Omim ID
600494Gene Ontology
HyperlinkGene Summary
POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).[supplied by OMIM
Other Designations
POU domain, class 3, transcription factor 2
-
Interactome
-
Disease
-
Publication Reference
-
Allele-specific silencing of mutant huntingtin and ataxin-3 genes by targeting expanded CAG repeats in mRNAs.
Hu J, Matsui M, Gagnon KT, Schwartz JC, Gabillet S, Arar K, Wu J, Bezprozvanny I, Corey DR.
Nature Biotechnology 2009 May; 27(5):478.
Application:WB, Human, Fibroblast cells.
-
Allele-specific silencing of mutant huntingtin and ataxin-3 genes by targeting expanded CAG repeats in mRNAs.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com