POU1F1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human POU1F1 full-length ORF ( NP_000297.1, 1 a.a. - 291 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
59.3
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — POU1F1
Entrez GeneID
5449GeneBank Accession#
NM_000306.1Protein Accession#
NP_000297.1Gene Name
POU1F1
Gene Alias
GHF-1, PIT1, Pit-1
Gene Description
POU class 1 homeobox 1
Omim ID
173110Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combined pituitary hormone deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
POU domain, class 1, transcription factor 1|growth hormone factor 1|pituitary specific transcription factor 1|pituitary-specific transcription factor 1
-
Interactome
-
Disease
-
Publication Reference
-
A Pit-1 Binding Site Adjacent to E-box133 in the Rat PRL Promoter is Necessary for Pulsatile Gene Expression Activity.
Bose S, Ganguly S, Kumar S, Boockfor FR.
Amino Acids 2016 Feb; 41(6):1390.
Application:Func, Oligos.
-
A Pit-1 Binding Site Adjacent to E-box133 in the Rat PRL Promoter is Necessary for Pulsatile Gene Expression Activity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com