Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLR2L purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00005441-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human POLR2L protein.
  • Immunogen:
  • POLR2L (NP_066951.1, 1 a.a. ~ 67 a.a) full-length human protein.
  • Sequence:
  • MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of POLR2L expression in transfected 293T cell line (H00005441-T04) by POLR2L MaxPab polyclonal antibody.

    Lane 1: POLR2L transfected lysate(7.60 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5441
  • Gene Name:
  • POLR2L
  • Gene Alias:
  • RBP10,RPABC5,RPB10,RPB10beta,RPB7.6,hRPB7.6,hsRPB10b
  • Gene Description:
  • polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
  • Gene Summary:
  • This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases. [provided by RefSeq
  • Other Designations:
  • DNA directed RNA polymerase II polypeptide L,polymerase (RNA) II (DNA directed) polypeptide L (7.6kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook