Product Browser

Last updated: 2017/4/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLR2K (Human) Recombinant Protein (P01)

  • Catalog # : H00005440-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human POLR2K full-length ORF ( AAH18157, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLAVFDAR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.12
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005440-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5440
  • Gene Name:
  • POLR2K
  • Gene Alias:
  • ABC10-alpha,RPABC4,RPB10alpha,RPB12,RPB7.0,hRPB7.0,hsRPB10a
  • Gene Description:
  • polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa
  • Gene Summary:
  • This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq
  • Other Designations:
  • DNA directed RNA polymerase II polypeptide K,DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide,polymerase (RNA) II (DNA directed) polypeptide K (7.0kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook