Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLR2F (Human) Recombinant Protein (Q01)

  • Catalog # : H00005435-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human POLR2F partial ORF ( AAH03582, 28 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005435-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5435
  • Gene Name:
  • POLR2F
  • Gene Alias:
  • HRBP14.4,POLRF,RPABC2,RPB14.4,RPB6
  • Gene Description:
  • polymerase (RNA) II (DNA directed) polypeptide F
  • Gene Summary:
  • This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes, that is also shared by the other two DNA-directed RNA polymerases. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. [provided by RefSeq
  • Other Designations:
  • DNA directed RNA polymerase II 14.4 kda polypeptide,DNA directed RNA polymerase II polypeptide F,RNA Polymerase II subunit 14.4 kD
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook