Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLR2E (Human) Recombinant Protein (P01)

  • Catalog # : H00005434-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human POLR2E full-length ORF ( AAH04441, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005434-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5434
  • Gene Name:
  • POLR2E
  • Gene Alias:
  • RPABC1,RPB5,XAP4,hRPB25,hsRPB5
  • Gene Description:
  • polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
  • Gene Summary:
  • This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. [provided by RefSeq
  • Other Designations:
  • DNA directed RNA polymerase II 23 kda polypeptide,DNA directed RNA polymerase II polypeptide E,polymerase (RNA) II (DNA directed) polypeptide E (25kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook