POLR2E (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human POLR2E full-length ORF ( AAH04441, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.84
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — POLR2E
Entrez GeneID
5434GeneBank Accession#
BC004441Protein Accession#
AAH04441Gene Name
POLR2E
Gene Alias
RPABC1, RPB5, XAP4, hRPB25, hsRPB5
Gene Description
polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
Omim ID
180664Gene Ontology
HyperlinkGene Summary
This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. [provided by RefSeq
Other Designations
DNA directed RNA polymerase II 23 kda polypeptide|DNA directed RNA polymerase II polypeptide E|polymerase (RNA) II (DNA directed) polypeptide E (25kD)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com