POLR2E purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of POLR2E expression in transfected 293T cell line (H00005434-T01) by POLR2E MaxPab polyclonal antibody.
Lane 1: POLR2E transfected lysate(23.1 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human POLR2E protein.
Immunogen
POLR2E (NP_002686.2, 1 a.a. ~ 210 a.a) full-length human protein.
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of POLR2E expression in transfected 293T cell line (H00005434-T01) by POLR2E MaxPab polyclonal antibody.
Lane 1: POLR2E transfected lysate(23.1 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — POLR2E
Entrez GeneID
5434GeneBank Accession#
NM_002695.2Protein Accession#
NP_002686.2Gene Name
POLR2E
Gene Alias
RPABC1, RPB5, XAP4, hRPB25, hsRPB5
Gene Description
polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
Omim ID
180664Gene Ontology
HyperlinkGene Summary
This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. [provided by RefSeq
Other Designations
DNA directed RNA polymerase II 23 kda polypeptide|DNA directed RNA polymerase II polypeptide E|polymerase (RNA) II (DNA directed) polypeptide E (25kD)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com