Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLR2D (Human) Recombinant Protein (P01)

  • Catalog # : H00005433-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human POLR2D full-length ORF ( AAH17205, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAAGGSDPRAGDVEEDASQLIFPKGFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.36
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005433-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5433
  • Gene Name:
  • POLR2D
  • Gene Alias:
  • HSRBP4,HSRPB4,RBP4
  • Gene Description:
  • polymerase (RNA) II (DNA directed) polypeptide D
  • Gene Summary:
  • This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq
  • Other Designations:
  • DNA directed RNA polymerase II polypeptide D,RNA polymerase II subunit hsRBP4
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook