Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLR2D polyclonal antibody (A01)

  • Catalog # : H00005433-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant POLR2D.
  • Immunogen:
  • POLR2D (AAH17205, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MAAGGSDPRAGDVEEDASQLIFPKGFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005433-A01
    Western Blot detection against Immunogen (41.73 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5433
  • Gene Name:
  • POLR2D
  • Gene Alias:
  • HSRBP4,HSRPB4,RBP4
  • Gene Description:
  • polymerase (RNA) II (DNA directed) polypeptide D
  • Gene Summary:
  • This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq
  • Other Designations:
  • DNA directed RNA polymerase II polypeptide D,RNA polymerase II subunit hsRBP4
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook