Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLB polyclonal antibody (A01)

  • Catalog # : H00005423-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant POLB.
  • Immunogen:
  • POLB (AAI06910.1, 224 a.a. ~ 333 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • POLB polyclonal antibody (A01), Lot # 050912JC01 Western Blot analysis of POLB expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5423
  • Gene Name:
  • POLB
  • Gene Alias:
  • MGC125976
  • Gene Description:
  • polymerase (DNA directed), beta
  • Gene Summary:
  • In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance. Also see POLA (MIM 312040).[supplied by OMIM
  • Other Designations:
  • DNA pol beta,DNA polymerase beta subunit
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook