Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PNMT MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00005409-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PNMT protein.
  • Immunogen:
  • PNMT (NP_002677.1, 1 a.a. ~ 282 a.a) full-length human protein.
  • Sequence:
  • MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PNMT expression in transfected 293T cell line (H00005409-T02) by PNMT MaxPab polyclonal antibody.

    Lane 1: PNMT transfected lysate(30.90 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of PNMT transfected lysate using anti-PNMT MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PNMT MaxPab mouse polyclonal antibody (B01) (H00005409-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5409
  • Gene Name:
  • PNMT
  • Gene Alias:
  • MGC34570,PENT,PNMTase
  • Gene Description:
  • phenylethanolamine N-methyltransferase
  • Gene Summary:
  • The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164271,noradrenaline N-methyltransferase,phenylethanolamine N-methylase
  • RSS
  • YouTube
  • Linkedin
  • Facebook