Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PNMT polyclonal antibody (A01)

  • Catalog # : H00005409-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PNMT.
  • Immunogen:
  • PNMT (NP_002677, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQEL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005409-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PNMT polyclonal antibody (A01), Lot # 051128JC01 Western Blot analysis of PNMT expression in IMR-32 ( Cat # L008V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5409
  • Gene Name:
  • PNMT
  • Gene Alias:
  • MGC34570,PENT,PNMTase
  • Gene Description:
  • phenylethanolamine N-methyltransferase
  • Gene Summary:
  • The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164271,noradrenaline N-methyltransferase,phenylethanolamine N-methylase
  • RSS
  • YouTube
  • Linkedin
  • Facebook