PRRX1 monoclonal antibody (M01), clone 1E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRRX1.
Immunogen
PRRX1 (NP_073207, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PRRX1 expression in transfected 293T cell line by PRRX1 monoclonal antibody (M01), clone 1E2.
Lane 1: PRRX1 transfected lysate (Predicted MW: 24.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRRX1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — PRRX1
Entrez GeneID
5396GeneBank Accession#
NM_022716Protein Accession#
NP_073207Gene Name
PRRX1
Gene Alias
PHOX1, PMX1, PRX1
Gene Description
paired related homeobox 1
Omim ID
167420Gene Ontology
HyperlinkGene Summary
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq
Other Designations
OTTHUMP00000033166|OTTHUMP00000033167|homeobox protein PHOX1|paired mesoderm homeo box 1|paired mesoderm homeobox 1|paired mesoderm homeobox 1 isoform pmx-1b
-
Interactome
-
Disease
-
Publication Reference
-
Downregulation of PRRX1 Confers Cancer Stem Cell-Like Properties and Predicts Poor Prognosis in Hepatocellular Carcinoma.
Hirata H, Sugimachi K, Takahashi Y, Ueda M, Sakimura S, Uchi R, Kurashige J, Takano Y, Nanbara S, Komatsu H, Saito T, Shinden Y, Iguchi T, Eguchi H, Atsumi K, Sakamoto K, Doi T, Hirakawa M, Honda H, Mimori K.
Annals of Surgical Oncology 2015 Dec; 22 Suppl 3:S1402.
Application:WB-Tr, Human, HuH7 cells.
-
Downregulation of PRRX1 Confers Cancer Stem Cell-Like Properties and Predicts Poor Prognosis in Hepatocellular Carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com