Product Browser

Last updated: 2017/12/10
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRRX1 polyclonal antibody (A01)

  • Catalog # : H00005396-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PRRX1.
  • Immunogen:
  • PRRX1 (NP_073207, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005396-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5396
  • Gene Name:
  • PRRX1
  • Gene Alias:
  • PHOX1,PMX1,PRX1
  • Gene Description:
  • paired related homeobox 1
  • Gene Summary:
  • The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000033166,OTTHUMP00000033167,homeobox protein PHOX1,paired mesoderm homeo box 1,paired mesoderm homeobox 1,paired mesoderm homeobox 1 isoform pmx-1b
  • RSS
  • YouTube
  • Linkedin
  • Facebook