PMS1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PMS1 partial ORF ( NP_000525, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
KELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADNFSTQYVLDGSGHILSQKPS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (88); Rat (86)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PMS1
Entrez GeneID
5378GeneBank Accession#
NM_000534Protein Accession#
NP_000525Gene Name
PMS1
Gene Alias
DKFZp781M0253, FLJ98259, HNPCC3, PMSL1, hPMS1
Gene Description
PMS1 postmeiotic segregation increased 1 (S. cerevisiae)
Omim ID
600258Gene Ontology
HyperlinkGene Summary
This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome. [provided by RefSeq
Other Designations
human homolog of yeast mutL|mismatch repair gene PMSL1|postmeiotic segregation 1|rhabdomyosarcoma antigen MU-RMS-40.10B|rhabdomyosarcoma antigen MU-RMS-40.10E
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com