PML monoclonal antibody (M04), clone 2B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PML monoclonal antibody (M04), clone 2B10. Western Blot analysis of PML expression in HepG2(Cat # L019V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PML is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PML on HeLa cell . [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PML.
Immunogen
PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (60)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PML monoclonal antibody (M04), clone 2B10. Western Blot analysis of PML expression in HepG2(Cat # L019V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PML is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PML on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PML
Entrez GeneID
5371GeneBank Accession#
BC000080Protein Accession#
AAH00080Gene Name
PML
Gene Alias
MYL, PP8675, RNF71, TRIM19
Gene Description
promyelocytic leukemia
Omim ID
102578Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
promyelocytic leukemia protein|promyelocytic leukemia, inducer of|tripartite motif protein TRIM19
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com