PLXNA2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PLXNA2 full-length ORF ( AAH32125, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.78
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PLXNA2
Entrez GeneID
5362GeneBank Accession#
BC032125Protein Accession#
AAH32125Gene Name
PLXNA2
Gene Alias
FLJ11751, FLJ30634, KIAA0463, OCT, PLXN2
Gene Description
plexin A2
Omim ID
601054Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. [provided by RefSeq
Other Designations
OTTHUMP00000034732|OTTHUMP00000063730|plexin 2|plexin-A2|semaphorin receptor OCT|transmembrane protein OCT
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Sympathetic nerve repulsion inhibited by designer molecules in vitro and role in experimental arthritis.
Kunath J, Delaroque N, Szardenings M, Neundorf I, Straub RH.
Life Sciences 2017 Jan; 168:47.
Application:Func, Mouse, Sympathetic ganglia from mouse.
-
Sympathetic nerve repulsion inhibited by designer molecules in vitro and role in experimental arthritis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com