PLXNA2 monoclonal antibody (M06), clone 2G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PLXNA2.
Immunogen
PLXNA2 (AAH32125, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.78 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PLXNA2 monoclonal antibody (M06), clone 2G5. Western Blot analysis of PLXNA2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
PLXNA2 monoclonal antibody (M06), clone 2G5. Western Blot analysis of PLXNA2 expression in HepG2(Cat # L019V1 ).Western Blot (Cell lysate)
PLXNA2 monoclonal antibody (M06), clone 2G5. Western Blot analysis of PLXNA2 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
PLXNA2 monoclonal antibody (M06), clone 2G5. Western Blot analysis of PLXNA2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PLXNA2 expression in transfected 293T cell line by PLXNA2 monoclonal antibody (M06), clone 2G5.
Lane 1: PLXNA2 transfected lysate (Predicted MW: 18.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PLXNA2 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — PLXNA2
Entrez GeneID
5362GeneBank Accession#
BC032125Protein Accession#
AAH32125Gene Name
PLXNA2
Gene Alias
FLJ11751, FLJ30634, KIAA0463, OCT, PLXN2
Gene Description
plexin A2
Omim ID
601054Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. [provided by RefSeq
Other Designations
OTTHUMP00000034732|OTTHUMP00000063730|plexin 2|plexin-A2|semaphorin receptor OCT|transmembrane protein OCT
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com