Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLS1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005357-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PLS1 partial ORF ( NP_002661.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.96
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005357-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5357
  • Gene Name:
  • PLS1
  • Gene Alias:
  • I-PLASTIN
  • Gene Description:
  • plastin 1 (I isoform)
  • Gene Summary:
  • Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this gene is a third distinct plastin isoform, which is specifically expressed at high levels in the small intestine. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • I isoform,Plastin-1,plastin 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook