PLS1 monoclonal antibody (M04), clone 3G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PLS1.
Immunogen
PLS1 (NP_002661.1, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PLS1 monoclonal antibody (M04), clone 3G10. Western Blot analysis of PLS1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PLS1 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — PLS1
Entrez GeneID
5357GeneBank Accession#
NM_002670Protein Accession#
NP_002661.1Gene Name
PLS1
Gene Alias
I-PLASTIN
Gene Description
plastin 1 (I isoform)
Omim ID
602734Gene Ontology
HyperlinkGene Summary
Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this gene is a third distinct plastin isoform, which is specifically expressed at high levels in the small intestine. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq
Other Designations
I isoform|Plastin-1|plastin 1
-
Interactome
-
Disease
-
Publication Reference
-
Plastin 1 widens stereocilia by transforming actin filament packing from hexagonal to liquid.
Krey JF, Krystofiak ES, Dumont RA, Vijayakumar S, Choi D, Rivero F, Kachar B, Jones SM, Barr-Gillespie PG.
Journal of Cell Biology 2016 Nov; 215(4):467.
Application:IF, WB, Mouse, Mouse hair bundles.
-
Plastin 1 widens stereocilia by transforming actin filament packing from hexagonal to liquid.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com