Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLOD1 polyclonal antibody (A01)

  • Catalog # : H00005351-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PLOD1.
  • Immunogen:
  • PLOD1 (NP_000293, 19 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGLGEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005351-A01
    Western Blot detection against Immunogen (36.67 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5351
  • Gene Name:
  • PLOD1
  • Gene Alias:
  • FLJ42041,LH,LH1,LLH,PLOD
  • Gene Description:
  • procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
  • Gene Summary:
  • Lysyl hydroxylase is a membrane-bound homodimeric protein localized to the cisternae of the endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VI have deficiencies in lysyl hydroxylase activity. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000002512,lysine hydroxylase,lysyl hydroxylase,lysyl hydroxylase 1,procollagen-lysine, 2-oxoglutarate 5-dioxygenase
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook