Product Browser

Last updated: 2017/5/21
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLN polyclonal antibody (A01)

  • Catalog # : H00005350-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PLN.
  • Immunogen:
  • PLN (AAH05269, 1 a.a. ~ 30 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MEKVQYLTRSAIRRASTIEMPQQARQKLQN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005350-A01
    Western Blot detection against Immunogen (29.3 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5350
  • Gene Name:
  • PLN
  • Gene Alias:
  • CMD1P,PLB
  • Gene Description:
  • phospholamban
  • Gene Summary:
  • The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017092,cardiac phospholamban
  • RSS
  • YouTube
  • Linkedin
  • Facebook