FXYD3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FXYD3 full-length ORF ( AAH05238, 21 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.11
Interspecies Antigen Sequence
Mouse (75); Rat (76)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FXYD3
Entrez GeneID
5349GeneBank Accession#
BC005238Protein Accession#
AAH05238Gene Name
FXYD3
Gene Alias
MAT-8, MAT8, MGC111076, PLML
Gene Description
FXYD domain containing ion transport regulator 3
Omim ID
604996Gene Ontology
HyperlinkGene Summary
This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms
Other Designations
FXYD domain-containing ion transport regulator 3|mammary tumor 8 kDa protein|phospholemman-like protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com