Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FXYD3 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00005349-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FXYD3 protein.
  • Immunogen:
  • FXYD3 (AAH05238, 21 a.a. ~ 87 a.a) full-length human protein.
  • Sequence:
  • NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FXYD3 expression in transfected 293T cell line (H00005349-T01) by FXYD3 MaxPab polyclonal antibody.

    Lane 1: FXYD3 transfected lysate(9.68 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5349
  • Gene Name:
  • FXYD3
  • Gene Alias:
  • MAT-8,MAT8,MGC111076,PLML
  • Gene Description:
  • FXYD domain containing ion transport regulator 3
  • Gene Summary:
  • This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms
  • Other Designations:
  • FXYD domain-containing ion transport regulator 3,mammary tumor 8 kDa protein,phospholemman-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook