PLEC1 monoclonal antibody (M02), clone 4D12

Catalog # H00005339-M02

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged PLEC1 is approximately 0.3ng/ml as a capture antibody.

QC Test

Western Blot detection against Immunogen (37.84 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant PLEC1.

    Immunogen

    PLEC1 (NP_000436, 4384 a.a. ~ 4493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (98); Rat (98)

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.84 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged PLEC1 is approximately 0.3ng/ml as a capture antibody.

    ELISA

  • Gene Info — PLEC1

    Entrez GeneID

    5339

    GeneBank Accession#

    NM_000445

    Protein Accession#

    NP_000436

    Gene Name

    PLEC1

    Gene Alias

    EBS1, EBSO, HD1, PCN, PLEC1b, PLTN

    Gene Description

    plectin 1, intermediate filament binding protein 500kDa

    Omim ID

    131950 226670 601282

    Gene Ontology

    Hyperlink

    Gene Summary

    Plectin is a prominent member of an important family of structurally and in part functionally related proteins, termed plakins or cytolinkers, that are capable of interlinking different elements of the cytoskeleton. Plakins, with their multi-domain structure and enormous size, not only play crucial roles in maintaining cell and tissue integrity and orchestrating dynamic changes in cytoarchitecture and cell shape, but also serve as scaffolding platforms for the assembly, positioning, and regulation of signaling complexes (for reviews see PMID: 9701547, 11854008 and 17499243). Plectin is expressed as several protein isoforms in a wide range of cell types and tissues from a single gene located on chromosome 8 (PMID: 8633055, 8698233). The plectin gene locus in mouse on chromosome 15 has been analyzed in detail (PMID: 10556294, 14559777), revealing a genomic exon-intron organization with well over 40 exons spanning over 62 kb and an unusual 5' transcript complexity of plectin isoforms. Eleven exons (1-1j) have been identified that alternatively splice directly into a common exon 2 which is the first exon to encode plectin's highly conserved actin binding domain (ABD). Three additional exons (-1, 0a, and 0) splice into an alternative first coding exon (1c), and two additional exons (2alpha and 3alpha) are optionally spliced within the exons encoding the acting binding domain (exons 2-8). Analysis of the human locus has identified eight of the eleven alternative 5' exons found in mouse and rat (PMID: 14672974). Furthermore, isoforms lacking the central rod domain encoded by exon 31 have been detected in mouse and rat (PMID:10556294, 9177781), and as judged by molecular size, have also been detected in human on the protein level (PMID: 11441066, 10780662). It has been shown that the short alternative amino-terminal sequences encoded by the different first exons direct the targeting of the various isoforms to distinct subcellular locations (PMID: 14559777). As the expression of specific plectin isoforms was found to be dependent on cell type (tissue) and stage of development (PMID: 10556294, 12542521, 17389230) it appears that each cell type (tissue) contains a unique set (proportion and composition) of plectin isoforms, as if custom-made for specific requirements of the particular cells. Concordantly, individual isoforms were found to carry out distinct and specific functions (PMID: 14559777, 12542521, 18541706). In 1996 a number of groups reported that patients

    Other Designations

    epidermolysis bullosa simplex 1 (Ogna)|hemidesmosomal protein 1|plectin 1|plectin 1, intermediate filament binding protein, 500kD

  • Interactome
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All