PLD2 monoclonal antibody (M01), clone 1C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PLD2 monoclonal antibody (M01), clone 1C5. Western Blot analysis of PLD2 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of PLD2 expression in transfected 293T cell line by PLD2 monoclonal antibody (M01), clone 1C5.
Lane 1: PLD2 transfected lysate (Predicted MW: 105.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PLD2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PLD2.
Immunogen
PLD2 (AAH15033, 834 a.a. ~ 933 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PLD2 monoclonal antibody (M01), clone 1C5. Western Blot analysis of PLD2 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of PLD2 expression in transfected 293T cell line by PLD2 monoclonal antibody (M01), clone 1C5.
Lane 1: PLD2 transfected lysate (Predicted MW: 105.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PLD2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — PLD2
Entrez GeneID
5338GeneBank Accession#
BC015033Protein Accession#
AAH15033Gene Name
PLD2
Gene Alias
-
Gene Description
phospholipase D2
Omim ID
602384Gene Ontology
HyperlinkGene Summary
Phosphatidylcholine (PC)-specific phospholipases D (PLDs; EC 3.1.4.4) catalyze the hydrolysis of PC to produce phosphatidic acid and choline. Activation of PC-specific PLDs occurs as a consequence of agonist stimulation of both tyrosine kinase and G protein-coupled receptors. PC-specific PLDs have been proposed to function in regulated secretion, cytoskeletal reorganization, transcriptional regulation, and cell cycle control.[supplied by OMIM
Other Designations
choline phosphatase 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Choline Is an Intracellular Messenger Linking Extracellular Stimuli to IP3-Evoked Ca2+ Signals through Sigma-1 Receptors.
Brailoiu E, Chakraborty S, Brailoiu GC, Zhao P, Barr JL, Ilies MA, Unterwald EM, Abood ME, Taylor CW.
Cell Reports 2019 Jan; 26(2):330.
Application：WB, Mouse, NG108-15 cells.
-
Inhibition of PLD1 activity causes ER stress via regulation of COPII vesicle formation.
Nakagawa H, Hazama K, Ishida K, Komori M, Nishimura K, Matsuo S.
Biochemical and Biophysical Research Communications 2017 Jun; 490(3):895.
Application：WB-Tr, Rat, Normal rat kidney (NRK) cells.
-
Construction of lentiviral shRNA expression vector targeting phospholipase D2 (PLD2) gene△.
Lian XF, Yu CX, He XL, Lin JJ, Chen YZ, Zhu L.
African Journal of Biotechnology 2011 Oct; 10 (66):15044.
Application：WB-Tr, Human, HEK 293FT cells.
-
Mechanisms for the activity of heterocyclic cyclohexanone curcumin derivatives in estrogen receptor negative human breast cancer cell lines.
Somers-Edgar TJ, Taurin S, Larsen L, Chandramouli A, Nelson MA, Rosengren RJ.
Investigational New Drugs 2011 Feb; 29(1):87.
Application：WB-Ce, Human, MDA-MB-231, SKBr3 cells.
-
Choline Is an Intracellular Messenger Linking Extracellular Stimuli to IP3-Evoked Ca2+ Signals through Sigma-1 Receptors.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com