PLCG1 monoclonal antibody (M01), clone 2A2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PLCG1 monoclonal antibody (M01), clone 2A2 Western Blot analysis of PLCG1 expression in Hela S3 NE ( Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PLCG1 is approximately 0.1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HCK and PLCG1. Huh7 cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-PLCG1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PTK2 and PLCG1. HeLa cells were stained with anti-PTK2 rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to PLCG1 on HeLa cell. [antibody concentration 40 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PLCG1.
Immunogen
PLCG1 (NP_002651, 1192 a.a. ~ 1291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PLCG1 monoclonal antibody (M01), clone 2A2 Western Blot analysis of PLCG1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PLCG1 is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between HCK and PLCG1. Huh7 cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-PLCG1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PTK2 and PLCG1. HeLa cells were stained with anti-PTK2 rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to PLCG1 on HeLa cell. [antibody concentration 40 ug/ml] -
Gene Info — PLCG1
Entrez GeneID
5335GeneBank Accession#
NM_002660Protein Accession#
NP_002651Gene Name
PLCG1
Gene Alias
PLC-II, PLC1, PLC148, PLCgamma1
Gene Description
phospholipase C, gamma 1
Omim ID
172420Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
1-phosphatidyl-D-myo-inositol-4,5-bisphosphate|1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1|OTTHUMP00000031787|OTTHUMP00000178982|PLC-gamma-1|inositoltrisphosphohydrolase|monophosphatidylinositol phosphodiesterase|phosphatidylinositol
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
An analysis of protein-protein interactions in cross-talk pathways reveals CRKL as a novel prognostic marker in hepatocellular carcinoma.
Liu CH, Chen TC, Chau GY, Jan YH, Chen CH, Hsu CN, Lin KT, Juang YL, Lu PJ, Cheng HC, Chen MH, Chang CF, Ting YS, Kao CY, Hsiao M, Huang CY.
Molecular & Cellular Proteomics 2013 May; 12(5):1335.
Application：Profiling, Human, Huh7 cells, Mahlavu cells.
-
An analysis of protein-protein interactions in cross-talk pathways reveals CRKL as a novel prognostic marker in hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com